Overview

  • Product name

  • Description

    Rabbit polyclonal to MARC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Cow, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human MARC1 aa 41-335. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    RRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLR DRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKT PTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPR RPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPN IVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEP LETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLL


    Database link: Q5VT66

  • Positive control

    • IHC-P: Human glioma, liver, kidney, stomach and stomach cancer tissues. WB: Human lung lysate; HepG2 cell lysate; Cow liver lysate; Recombinant human MARC1 protein.
  • General notes

     This product was previously labelled as MOSC1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233111 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Relevance

    MOSC1 is a probable oxidoreductase.
  • Cellular localization

    Mitochondrial
  • Database links

  • Alternative names

    • FLJ22390 antibody
    • MARC1 antibody
    • Mitochondrial amidoxime reducing component 1 antibody
    • MOCO sulphurase C terminal domain containing 1 antibody
    • MOSC 1 antibody
    • MOSC domain containing protein 1 mitochondrial antibody
    see all

Images

  • Paraffin-embedded human glioma tissue stained for MARC1 using ab233111 at 20 µg/ml in immunohistochemical analysis. DAB staining.      

  • Paraffin-embedded human liver tissue stained for MARC1 using ab233111 at 20 µg/ml in immunohistochemical analysis. DAB staining.  

  • Paraffin-embedded human kidney tissue stained for MARC1 using ab233111 at 20 µg/ml in immunohistochemical analysis. DAB staining.  

  • Paraffin-embedded human stomach tissue stained for MARC1 using ab233111 at 20 µg/ml in immunohistochemical analysis. DAB staining.  

  • Paraffin-embedded human stomach cancer tissue stained for MARC1 using ab233111 at 20 µg/ml in immunohistochemical analysis. DAB staining.  

  • Anti-MARC1 antibody (ab233111) at 2 µg/ml + Recombinant human MARC1 protein

    Predicted band size: 37 kDa

  • Anti-MARC1 antibody (ab233111) at 2 µg/ml + Human lung lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab

    Predicted band size: 37 kDa

  • Anti-MARC1 antibody (ab233111) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab

    Predicted band size: 37 kDa

  • Anti-MARC1 antibody (ab233111) at 2 µg/ml + Cow liver lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/1000 dilution

    Predicted band size: 37 kDa

References

ab233111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up