Overview

  • Product name

  • Description

    Rabbit polyclonal to MARCH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human MARCH2 aa 198-246.
    Sequence:

    RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV


    Database link: Q9P0N8

  • Positive control

    • Human colon tissue; MARCH2 overexpression HEK293T lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab220292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 27 kDa.

Target

  • Function

    E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
  • Tissue specificity

    Broadly expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Endoplasmic reticulum membrane. Lysosome membrane. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase MARCH2 antibody
    • E3 ubiquitin-protein ligase MARCH2 antibody
    • EC 6.3.2.- antibody
    • HSPC240 antibody
    • MARCH 2 antibody
    • MARCH II antibody
    • MARCH-II antibody
    • march2 antibody
    • MARH2_HUMAN antibody
    • Membrane associated RING CH protein II antibody
    • Membrane associated ring finger (C3HC4) 2 antibody
    • Membrane associated RING finger protein 2 antibody
    • Membrane-associated RING finger protein 2 antibody
    • Membrane-associated RING-CH protein II antibody
    • RING finger protein 172 antibody
    • RNF172 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human colon tissue labeling MARCH2 with ab220292 at 1/20 dilution.

  • All lanes : Anti-MARCH2 antibody (ab220292) at 1/100 dilution

    Lane 1 : Negative control (vector only transfected HEK293T lysate)
    Lane 2 : MARCH2 overexpression HEK293T lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa)

    Predicted band size: 27 kDa

References

ab220292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up