Overview

  • Product name

  • Description

    Rabbit polyclonal to MARCH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human MARCH2 aa 146-195 (internal sequence).
    Sequence:

    LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV

  • Positive control

    • Jurkat cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab76397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay, 1:312500.

Target

  • Function

    E3 ubiquitin-protein ligase that may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May be involved in endosomal trafficking through interaction with STX6.
  • Tissue specificity

    Broadly expressed.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Endoplasmic reticulum membrane. Lysosome membrane. Endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase MARCH2 antibody
    • E3 ubiquitin-protein ligase MARCH2 antibody
    • EC 6.3.2.- antibody
    • HSPC240 antibody
    • MARCH 2 antibody
    • MARCH II antibody
    • MARCH-II antibody
    • march2 antibody
    • MARH2_HUMAN antibody
    • Membrane associated RING CH protein II antibody
    • Membrane associated ring finger (C3HC4) 2 antibody
    • Membrane associated RING finger protein 2 antibody
    • Membrane-associated RING finger protein 2 antibody
    • Membrane-associated RING-CH protein II antibody
    • RING finger protein 172 antibody
    • RNF172 antibody
    see all

Images

References

This product has been referenced in:

  • Han SO  et al. MARCH2 promotes endocytosis and lysosomal sorting of carvedilol-bound ß(2)-adrenergic receptors. J Cell Biol 199:817-30 (2012). WB . Read more (PubMed: 23166351) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab76397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up