Overview

  • Product name

  • Description

    Rabbit polyclonal to MARCH3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human MARCH3 aa 111-160. The exact sequence is proprietary.
    Sequence:

    SYCELCHFRFAVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLAT


    Database link: Q86UD3

  • Positive control

    • Human brain cortex tissue; K562 and COS7 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab190219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 29 kDa.

Target

  • Function

    E3 ubiquitin-protein ligase which may be involved in endosomal trafficking. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Cytoplasmic vesicle membrane. Early endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • E3 ubiquitin protein ligase MARCH3 antibody
    • E3 ubiquitin-protein ligase MARCH3 antibody
    • FLJ20096 antibody
    • March 3 antibody
    • MARCH III antibody
    • MARCH-III antibody
    • March3 antibody
    • MARH3_HUMAN antibody
    • Membrane associated RING CH protein III antibody
    • Membrane associated ring finger (C3HC4) 3 antibody
    • Membrane associated ring finger (C3HC4) 3, E3 ubiquitin protein ligase antibody
    • Membrane associated RING finger protein 3 antibody
    • Membrane-associated RING finger protein 3 antibody
    • Membrane-associated RING-CH protein III antibody
    • MGC48332 antibody
    • RING finger protein 173 antibody
    • RNF173 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human brain cortex tissue labeling MARCH3 with ab190219 at 10 µg/ml.

  • All lanes : Anti-MARCH3 antibody (ab190219) at 1/500 dilution

    Lane 1 : K562 cell extract
    Lane 2 : COS7 cell extract
    Lane 3 : K562 cell extract with immunizing peptide

    Predicted band size: 29 kDa

References

ab190219 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up