Overview

  • Product name

  • Description

    Rabbit polyclonal to MARCH6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MARCH6 aa 544-628.
    Sequence:

    HTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARN NNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLN


    Database link: O60337

  • Positive control

    • SiHa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100.

 

Target

  • Relevance

    MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes.
  • Cellular localization

    Endoplasmic reticulum membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • DOA10 antibody
    • Doa10 homolog antibody
    • E3 ubiquitin protein ligase MARCH6 antibody
    • KIAA0597 antibody
    • MARCH 6 antibody
    • MARCH VI antibody
    • MARCHVI antibody
    • Membrane associated RING CH protein VI antibody
    • Membrane associated ring finger (C3HC4) 6 antibody
    • Membrane associated RING finger protein 6 antibody
    • Protein TEB 4 antibody
    • Protein TEB4 antibody
    • RING finger protein 176 antibody
    • RNF 176 antibody
    • RNF176 antibody
    • TEB 4 antibody
    • TEB4 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SiHa cells labeling MARCH6 with ab220290 at 4 µg/ml (green).

References

ab220290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up