Overview

  • Product name

  • Description

    Rabbit polyclonal to MARCH8/MIR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Synthetic peptide corresponding to Human MARCH8/MIR aa 1-50 (N terminal).
    Sequence:

    MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS


    Database link: NP_001002265

  • Positive control

    • PANC1 cell lysate
  • General notes

     This product was previously labelled as MARCH8

     

Properties

Applications

Our Abpromise guarantee covers the use of ab99229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 33 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
  • Tissue specificity

    Broadly expressed. Present in immature dendritic cells (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-CH-type zinc finger.
  • Domain

    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Cytoplasmic vesicle membrane. Lysosome membrane. Early endosome membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • c MIR antibody
    • c-MIR antibody
    • Cellular modulator of immune recognition antibody
    • E3 ubiquitin protein ligase MARCH8 antibody
    • E3 ubiquitin-protein ligase MARCH8 antibody
    • MARCH 8 antibody
    • MARCH VIII antibody
    • MARCH-VIII antibody
    • MARCH8 antibody
    • MARH8_HUMAN antibody
    • Membrane associated RING CH protein VIII antibody
    • Membrane associated ring finger (C3HC4) 8 antibody
    • Membrane associated RING finger protein 8 antibody
    • Membrane-associated RING finger protein 8 antibody
    • Membrane-associated RING-CH protein VIII antibody
    • MIR antibody
    • OTTHUMP00000058921 antibody
    • RING finger protein 178 antibody
    • RNF178 antibody
    see all

Images

  • Anti-MARCH8/MIR antibody (ab99229) at 1 µg/ml + PANC1 cell lysate at 10 µg

    Predicted band size: 33 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Zhang X  et al. N-myc downstream-regulated gene 1 promotes apoptosis in colorectal cancer via up-regulating death receptor 4. Oncotarget 8:82593-82608 (2017). Read more (PubMed: 29137287) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up