Anti-MARCO/Macrophage receptor with collagenous structure antibody (ab231046)

Overview

  • Product name

    Anti-MARCO/Macrophage receptor with collagenous structure antibody
    See all MARCO/Macrophage receptor with collagenous structure primary antibodies
  • Description

    Rabbit polyclonal to MARCO/Macrophage receptor with collagenous structure
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat MARCO/Macrophage receptor with collagenous structure aa 318-470. (Expressed E.coli).
    Sequence:

    GVPGLVGRKGDTGSPGLAGPKGEPGRAGLKGEPGMKGSSGQQGQKGEKGQ KGDFNLVVRIVGGTSRGRAEVYYNNVWGTICDDGWDNNDATVFCRMLGYS SGRGLGSFGGGTGKIWLDDVSCLGTEATLWDCRKSSWGSHNCNHNEDAGV ECR


    Database link: M0R9F7

  • Positive control

    • WB: Recombinant rat MARCO/Macrophage receptor with collagenous structure protein; Human leukocyte lysate. IHC-P: Rat thymus tissue. Rat lung tissue.
  • General notes

     This product was previously labelled as MARCO

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 47 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Paraffin-embedded rat thymus tissue stained for MARCO/Macrophage receptor with collagenous structure with ab231046 at 20 µg/ml in immunohistochemical analysis. AEC staining.

  • Anti-MARCO/Macrophage receptor with collagenous structure antibody (ab231046) at 2 µg/ml + Human leukocyte lysate

    Predicted band size: 47 kDa

  • Anti-MARCO/Macrophage receptor with collagenous structure antibody (ab231046) at 2 µg/ml + Recombinant rat MARCO/Macrophage receptor with collagenous structure protein

    Predicted band size: 47 kDa

  • Formalin-fixed, paraffin-embedded rat lung tissue stained for MARCO/Macrophage receptor with collagenous structure with ab231046 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab231046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up