Overview

  • Product name

    Anti-MARV GP antibody (Biotin)
  • Description

    Rabbit polyclonal to MARV GP (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Other species
  • Immunogen

    Synthetic peptide within MARV GP aa 436-681. The exact sequence is proprietary. Sequence is specific to the GP2 subunit.
    Sequence:

    SILWREGDMFPFLDGLINAPIDFDPVPNTKTIFDESSSSGASAEEDQHAS PNISLTLSYFPNINENTAYSGENENDCDAELRIWSVQEDDLAAGLSWIPF FGPGIEGLYTAVLIKNQNNLVCRLRRLANQTAKSLELLLRVTTEERTFSL INRHAIDFLLTRWGGTCKVLGPDCCIGIEDLSKNISEQIDQIKKDEQKEG TGWGLGGKWWTSDWGVLTNLGILLLLSIAVLIALSCICRIFTKYIG


    Database link: P35253

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab190459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 74 kDa.

Target

  • Relevance

    GP1 is responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into the host cell. Binding to CD209 and CLEC4M, which are respectively found on dendritic cells (DCs), and on endothelial cells of liver sinusoids and lymph node sinuses, facilitate infection of macrophages and endothelial cells. These interactions not only facilitate virus cell entry, but also allow capture of viral particles by DCs and subsequent transmission to susceptible cells without DCs infection (trans infection). GP2 acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in GP2, releasing the fusion hydrophobic peptide.
  • Cellular localization

    GP2: Virion membrane; Single-pass type I membrane protein. Virion membrane; Lipid-anchor. Host cell membrane; Single-pass type I membrane protein. Host cell membrane; Lipid-anchor. Note: In the cell, localizes to the plasma membrane lipid rafts, which probably represent the assembly and budding site. GP1: Virion membrane; Peripheral membrane protein By similarity. Host cell membrane; Peripheral membrane protein. Note: GP1 is not anchored to the viral envelope, but associates with the extravirion surface through its binding to GP2. In the cell, both GP1 and GP2 localize to the plasma membrane lipid rafts, which probably represent the assembly and budding site.
  • Database links

    • Alternative names

      • Envelope glycoprotein antibody
      • GP1 antibody
      • GP1,2 antibody
      • GP2 antibody
      • Marburg virus antibody
      • Virion spike glycoprotein antibody
      see all

    Images

    • Lane 1 : Anti-MARV GP antibody (Biotin) (ab190459) at 0.0001 µg
      Lane 2 : Anti-MARV GP antibody (Biotin) (ab190459) at 0.0005 µg
      Lane 3 : Anti-MARV GP antibody (Biotin) (ab190459) at 0.001 µg
      Lane 4 : Anti-MARV GP antibody (Biotin) (ab190459) at 0.005 µg

      All lanes : Streptavidin-HRP

      Lysates/proteins at 1/6000 dilution per lane.

      Predicted band size: 74 kDa



      TMB substrate was used for visualization.

    References

    ab190459 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab190459.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up