Overview

  • Product name

  • Description

    Rabbit polyclonal to MAS1L
  • Host species

    Rabbit
  • Specificity

    This antibody detects endogenous levels of MAS1L protein.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human MAS1L aa 42-87. The exact sequence is proprietary.
    Sequence:

    NLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIAPKAVLVSL


    Database link: P35410

  • Positive control

    • HEK293T, NIH3T3 and PC12 whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab200685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 42 kDa.

Target

  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ994E9.2 antibody
    • MAS L antibody
    • MAS R antibody
    • Mas related G protein coupled MRG antibody
    • Mas related G protein coupled receptor antibody
    • MAS-R antibody
    • Mas-related G-protein coupled receptor MRG antibody
    • MAS1 oncogene like antibody
    • MAS1 proto-oncogene like, G protein-coupled receptor antibody
    • MAS1-like antibody
    • MAS1L antibody
    • MAS1L_HUMAN antibody
    • MGC119987 antibody
    • MRG antibody
    see all

Images

  • All lanes : Anti-MAS1L antibody (ab200685)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : NIH3T3 whole cell lysate
    Lane 3 : PC12 whole cell lysate

    Predicted band size: 42 kDa

References

This product has been referenced in:

  • Zheng J  et al. Effects of IQP, VEP and Spirulina platensis hydrolysates on the local kidney renin angiotensin system in spontaneously hypertensive rats. Mol Med Rep 16:8485-8492 (2017). Read more (PubMed: 28944898) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up