Overview

  • Product name

  • Description

    Rabbit polyclonal to MAS1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAS1L aa 318-378.
    Sequence:

    GSLRKKRLKESLRVILQRALADKPEVGRNKKAAGIDPMEQPHSTQHVENL LPREHRVDVET


    Database link: P35410

  • Positive control

    • WB: Colo320 and HeLa whole cell lysate IHC-P: Human breast cancer and lung cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236754 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 42 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ994E9.2 antibody
    • MAS L antibody
    • MAS R antibody
    • Mas related G protein coupled MRG antibody
    • Mas related G protein coupled receptor antibody
    • MAS-R antibody
    • Mas-related G-protein coupled receptor MRG antibody
    • MAS1 oncogene like antibody
    • MAS1 proto-oncogene like, G protein-coupled receptor antibody
    • MAS1-like antibody
    • MAS1L antibody
    • MAS1L_HUMAN antibody
    • MGC119987 antibody
    • MRG antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for MAS1L using ab236754 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for MAS1L (Green) using ab236754 at 1/100 dilution in ICC/IF, folowed by Alexa Fluor®488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human breast cancer tissue stained for MAS1L using ab236754 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-MAS1L antibody (ab236754) at 1/500 dilution

    Lane 1 : COLO 320 whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 42 kDa

References

ab236754 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236754.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up