Overview

  • Product name

    Anti-Mast Cell Chymase antibody
    See all Mast Cell Chymase primary antibodies
  • Description

    Rabbit polyclonal to Mast Cell Chymase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse Mast Cell Chymase aa 9-247. (Expressed in E.coli).
    Sequence:

    LLLLLGSSTKAGEIIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRR NFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVV HDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPA SDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPL LCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILREN


    Database link: P21844

  • Positive control

    • WB: Mouse large intestine and testis tissue; PC-3 cell lysate; Recombinant mouse Mast Cell Chymase protein. IHC-P: Mouse lung and uterine fibroids tissue. ICC/IF: PC-3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
  • Tissue specificity

    Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions.
  • Sequence similarities

    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted. Cytoplasmic granule. Mast cell granules.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha-chymase antibody
    • Chymase 1 antibody
    • Chymase 1 mast cell antibody
    • chymase 1 preproprotein transcript E antibody
    • chymase 1 preproprotein transcript I antibody
    • Chymase antibody
    • Chymase, heart antibody
    • Chymase, mast cell antibody
    • CMA1 antibody
    • CMA1_HUMAN antibody
    • CYH antibody
    • CYM antibody
    • EC 3.4.21.39 antibody
    • Mast cell chymase 1 antibody
    • Mast cell protease 3 antibody
    • Mast cell protease 5 antibody
    • Mast cell protease I antibody
    • Mast cell protease III antibody
    • Mcp-5 antibody
    • MCP3P antibody
    • Mcpt5 antibody
    • MCT1 antibody
    • MGC119890 antibody
    • MGC119891 antibody
    • MMCP-5 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse uterine fibroids tissue stained for Mast Cell Chymase using ab233103 at 20 μg/mL in immunohistochemical analysis. DAB staining.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for Mast Cell Chymase using ab233103 (green) at 20 μg/mL in ICC/IF. FITC-labeled secondary antibody.

  • Formalin-fixed, paraffin-embedded mouse lung tissue stained for Mast Cell Chymase using ab233103 at 20 μg/mL in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-Mast Cell Chymase antibody (ab233103) at 2 µg/ml

    Lane 1 : Mouse large intestine lysate
    Lane 2 : Mouse testis lysate
    Lane 3 : PC-3 (human prostate adenocarcinoma cell line) cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 28 kDa

  • Anti-Mast Cell Chymase antibody (ab233103) at 2 µg/ml + Recombinant mouse Mast Cell Chymase protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 28 kDa

References

ab233103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up