Overview

  • Product name

    Anti-Mast Cell Tryptase antibody
    See all Mast Cell Tryptase primary antibodies
  • Description

    Rabbit polyclonal to Mast Cell Tryptase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Dog
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Dog Mast Cell Tryptase aa 151-275. (Expressed in E.coli).
    Sequence:

    TGTPCWVTGWGDVHSGTPLPPPFPLKQVKVPIVENSMCDVQYHLGLSTGD GVRIVREDMLCAGNSKSDSCQGDSGGPLVCRVRGVWLQAGVVSWGEGCAQ PNRPGIYTRVAYYLDWIHQYVPKEP


    Database link: P15944

  • Positive control

    • WB: Canine lung tissue; Recombinant canine Mast Cell Tryptase protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 30 kDa.

Target

  • Relevance

    Mast cells contain a number of preformed chemical mediators such as histamine, chymase, carboxypeptidase and proteolytic tryptase. Human Mast Cell Tryptase is considered to be an important marker of mast cell activation as well as an important mediator of inflammation.
  • Cellular localization

    Secreted. Note: released from the secretory granules upon mast cell activation.
  • Alternative names

    • alpha II antibody
    • Lung tryptase antibody
    • Mast cell alpha II tryptase antibody
    • Mast cell beta I tryptase antibody
    • Mast cell protease 7 antibody
    • Mast cell protease II antibody
    • MCP 7 antibody
    • Pituitary tryptase antibody
    • Skin tryptase antibody
    • TPS 1 antibody
    • TPS1 antibody
    • TPS2 antibody
    • TPSAB1 antibody
    • TPSAB1 protein antibody
    • TPSB1 antibody
    • Tryptase 1 antibody
    • Tryptase alpha 1 antibody
    • tryptase alpha I included antibody
    • Tryptase alpha II antibody
    • tryptase alpha II included antibody
    • tryptase alpha included antibody
    • tryptase alpha/beta 1 antibody
    • Tryptase beta 1 antibody
    • tryptase beta I included antibody
    • Tryptase I antibody
    • tryptase I included antibody
    • Tryptase III antibody
    • Tryptase skin antibody
    see all

Images

  • Anti-Mast Cell Tryptase antibody (ab231714) at 2 µg/ml + Canine lung tissue

    Predicted band size: 30 kDa

  • Anti-Mast Cell Tryptase antibody (ab231714) at 2 µg/ml + Recombinant canine Tryptase protein

    Predicted band size: 30 kDa

References

ab231714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up