Overview

  • Product name

    Anti-MAST1 antibody
  • Description

    Rabbit polyclonal to MAST1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MAST1 aa 687-879.
    Sequence:

    SYDEDDTTEEEPVEIRQFSSCSPRFSKVYSSMEQLSQHEPKTPVAAAGSS KREPSTKGPEEKVAGKREGLGGLTLREKTWRGGSPEIKRFSASEASFLEG EASPPLGARRRFSALLEPSRFSAPQEDEDEARLRRPPRPSSDPAGSLDAR APKEETQGEGTSSAGDSEATDRPRPGDLCPPSKDGDASGPRAT


    Database link: Q9Y2H9

  • Positive control

    • IHC-P: Human prostate cancer and brain tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cell membrane. Cytoplasm, cytoskeleton. Colocalizes with syntrophins at the cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 9430008B02Rik antibody
    • KIAA0973 antibody
    • MAST 1 antibody
    • MAST1 antibody
    • MAST1_HUMAN antibody
    • Microtubule associated serine/threonine kinase 1 antibody
    • Microtubule associated serine/threonine protein kinase 1 antibody
    • Microtubule-associated serine/threonine-protein kinase 1 antibody
    • SAST 124 antibody
    • SAST 170 antibody
    • SAST antibody
    • SAST170 antibody
    • Syntrophin associated serine/threonine kinase antibody
    • Syntrophin associated serine/threonine protein kinase antibody
    • Syntrophin-associated serine/threonine-protein kinase antibody
    see all

Images

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for MAST1 (green) using ab234659 at 1/100 dilution in ICC/IF. Secondary used is an Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human prostate cancer tissue stained for MAST1 with ab234659 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for MAST1 with ab234659 at 1/100 dilution in immunohistochemical analysis.

References

ab234659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up