Overview

  • Product name

  • Description

    Rabbit polyclonal to MAST205
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MAST205 aa 68-144.
    Sequence:

    LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSS SVHSSVGQVTWQSSGEASNLVRMRNQS


    Database link: Q6P0Q8

  • Positive control

    • IHC-P: Human testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins. Functions in a multi-protein complex in spermatid maturation. Regulates lipopolysaccharide-induced IL-12 synthesis in macrophages by forming a complex with TRAF6, resulting in the inhibition of TRAF6 NF-kappa-B activation.
  • Tissue specificity

    Abundant in the testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated and ubiquitinated. N-terminal ubiquitination leads to degradation of MAST2 by proteasome-mediated proteolysis. N-terminal phosphorylation appears to be a prerequisite for ubiquitination.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell membrane. Recruited to the sub-membranous area on interaction with CDHR2.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.11.1 3 antibody
    • FLJ39200 antibody
    • KIAA0807 antibody
    • MAST 2 antibody
    • MAST 205 antibody
    • Mast2 antibody
    • MAST2_HUMAN antibody
    • Microtubule associated serine/threonine kinase 2 antibody
    • Microtubule associated testis specific serine/threonine protein kinase antibody
    • Microtubule-associated serine/threonine-protein kinase 2 antibody
    • MTSSK antibody
    • OTTHUMP00000009697 2 antibody
    • OTTHUMP00000046616 antibody
    • RP4 533D7.1 antibody
    • RP4-533D7.1 2 antibody
    see all

Images

  • Paraffin embedded human testis tissue stained for MAST205 with ab224556 (1/20 dilution) in immunohistochemical analysis.

References

ab224556 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up