Overview

  • Product name

  • Description

    Rabbit polyclonal to MAST205
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MAST205 aa 512-785. (N-terminal His-tag and GST-tag; Expressed in E.coli).
    Sequence:

    FETIKLISNGAYGAVFLVRHKSTRQRFAMKKINKQNLILRNQIQQAFVER DILTFAENPFVVSMFCSFDTKRHLCMVMEYVEGGDCATLLKNIGALPVDM VRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMGHIKLTDFGLSKIGL MSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVDWWAM GIILYEFLVGCVPFF


    Database link: Q6P0Q8-1

  • Positive control

    • IHC-P: Human testis tissue. WB: Pig cerebrum lysate; Recombinant human MAST205 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab233182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 196 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Appears to link the dystrophin/utrophin network with microtubule filaments via the syntrophins. Phosphorylation of DMD or UTRN may modulate their affinities for associated proteins. Functions in a multi-protein complex in spermatid maturation. Regulates lipopolysaccharide-induced IL-12 synthesis in macrophages by forming a complex with TRAF6, resulting in the inhibition of TRAF6 NF-kappa-B activation.
  • Tissue specificity

    Abundant in the testis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 PDZ (DHR) domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated and ubiquitinated. N-terminal ubiquitination leads to degradation of MAST2 by proteasome-mediated proteolysis. N-terminal phosphorylation appears to be a prerequisite for ubiquitination.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell membrane. Recruited to the sub-membranous area on interaction with CDHR2.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 2.7.11.1 3 antibody
    • FLJ39200 antibody
    • KIAA0807 antibody
    • MAST 2 antibody
    • MAST 205 antibody
    • Mast2 antibody
    • MAST2_HUMAN antibody
    • Microtubule associated serine/threonine kinase 2 antibody
    • Microtubule associated testis specific serine/threonine protein kinase antibody
    • Microtubule-associated serine/threonine-protein kinase 2 antibody
    • MTSSK antibody
    • OTTHUMP00000009697 2 antibody
    • OTTHUMP00000046616 antibody
    • RP4 533D7.1 antibody
    • RP4-533D7.1 2 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for MAST205 using ab233182 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-MAST205 antibody (ab233182) at 2 µg/ml + Recombinant human MAST205 protein

    Predicted band size: 196 kDa

  • Pig cerebrum lysate

    Predicted band size: 196 kDa

References

ab233182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up