Overview

  • Product name

  • Description

    Rabbit polyclonal to MATE-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MATE-1 aa 472-541.
    Sequence:

    HANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQM RQEEPLPEHPQDGAKLSRKQ


    Database link: Q96FL8

  • Positive control

    • IHC-P: Human adrenal gland tissue.
  • General notes

    Protein previously labeled as SLC47A1.

Properties

Applications

Our Abpromise guarantee covers the use of ab224440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Solute transporter for tetraethylammonium (TEA), 1-methyl-4-phenylpyridinium (MPP), cimetidine, N-methylnicotinamide (NMN), metformin, creatinine, guanidine, procainamide, topotecan, estrone sulfate, acyclovir, ganciclovir and also the zwitterionic cephalosporin, cephalexin and cephradin. Seems to also play a role in the uptake of oxaliplatin (a new platinum anticancer agent). Able to transport paraquat (PQ or N,N-dimethyl-4-4'-bipiridinium); a widely used herbicid. Responsible for the secretion of cationic drugs across the brush border membranes.
  • Tissue specificity

    Expressed in adrenal gland, and to a lower extent in liver, skeletal muscle and kidney (especially found in luminal membranes of the urinary tubules, bile caniculi and brush border membranes).
  • Sequence similarities

    Belongs to the multi antimicrobial extrusion (MATE) (TC 2.A.66.1) family.
  • Cellular localization

    Cell membrane. Predominantly localized at the plasma membrane but also found in intracellular organelles.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ10847 antibody
    • hMATE-1 antibody
    • hMATE1 antibody
    • MATE-1 antibody
    • MATE1 antibody
    • MGC6482 antibody
    • multidrug and toxin extrusion 1 antibody
    • Multidrug and toxin extrusion protein 1 antibody
    • S47A1_HUMAN antibody
    • SLC47A1 antibody
    • Solute carrier family 47 member 1 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for MATE-1 using ab224440 at 1/50 dilution in immunohistochemical analysis.

References

ab224440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up