Overview

  • Product name

    Anti-MATH2/NEUROD6 antibody
    See all MATH2/NEUROD6 primary antibodies
  • Description

    Rabbit polyclonal to MATH2/NEUROD6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Cow, Human, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human MATH2/NEUROD6 aa 170-314.
    Sequence:

    SQPTTNLVAGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTP PGHGTLDNSKSMKPYNYCSAYESFYESTSPECASPQFEGPLSPPPINYNG IFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHF


    Database link: Q96NK8

  • Positive control

    • WB: Mouse brain tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab234844 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 39 kDa.

Target

  • Function

    Activates E box-dependent transcription in collaboration with TCF3/E47. May be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. Transactivates the promoter of its own gene.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Atoh 2 antibody
    • Atoh2 antibody
    • Atonal homolog 2 antibody
    • Atonal protein homolog 2 antibody
    • Atonal protein homolog2 antibody
    • bHLH a2 antibody
    • bHLHa 2 antibody
    • bHLHa2 antibody
    • Class A basic helix-loop-helix protein 2 antibody
    • Helix loop helix protein mATH 2 antibody
    • Helix loop helix protein mATH2 antibody
    • MATH 2 antibody
    • Math2 antibody
    • NDF 6 antibody
    • NDF6 antibody
    • NDF6_HUMAN antibody
    • Neuro D6 antibody
    • NeuroD6 antibody
    • Neurogenic differentiation 6 antibody
    • Neurogenic differentiation factor 6 antibody
    • Nex 1 antibody
    • Nex 1m antibody
    • Nex antibody
    • Nex1 antibody
    • Nex1 m antibody
    • Nex1m antibody
    • Protein atonal homolog 2 antibody
    • Protein atonal homolog2 antibody
    see all

Images

  • Anti-MATH2/NEUROD6 antibody (ab234844) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 39 kDa

References

ab234844 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234844.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up