Overview

  • Product name

    Anti-MATN3/Matrilin-3 antibody
    See all MATN3/Matrilin-3 primary antibodies
  • Description

    Rabbit polyclonal to MATN3/Matrilin-3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MATN3/Matrilin-3 aa 277-486.
    Sequence:

    HVCISDGEGKHHCECSQGYTLNADKKTCSALDRCALNTHGCEHICVNDRS GSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHHCECY EGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNED KKTCSATEEARRLVSTEDACGCEATLAFQDKVSSYLQRLNTKLDDILEKL KINEYGQIHR


    Database link: O15232-1

  • Positive control

    • IHC-P: Human kidney and adrenal gland tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as MATN3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab238893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Major component of the extracellular matrix of cartilage and may play a role in the formation of extracellular filamentous networks.
  • Tissue specificity

    Expressed only in cartilaginous tissues, such as vertebrae, ribs and shoulders.
  • Involvement in disease

    Multiple epiphyseal dysplasia 5
    Spondyloepimetaphyseal dysplasia MATN3-related
    Osteoarthritis 2
  • Sequence similarities

    Contains 4 EGF-like domains.
    Contains 1 VWFA domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AV009181 antibody
    • DIPOA antibody
    • EDM5 antibody
    • HOA antibody
    • MATN3 antibody
    • MATN3_HUMAN antibody
    • Matrilin 3 antibody
    • Matrilin-3 antibody
    • OADIP antibody
    • OS2 antibody
    see all

Images

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for MATN3/Matrilin-3 (Green) using ab238893 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human kidney tissue stained for MATN3/Matrilin-3 with ab238893 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for MATN3/Matrilin-3 with ab238893 at a 1/100 dilution in immunohistochemical analysis.

References

ab238893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up