Anti-Matrin 3 antibody (ab246997)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Matrin 3 antibody
See all Matrin 3 primary antibodies -
Description
Rabbit polyclonal to Matrin 3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human Matrin 3 aa 399-488.
Sequence:VVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQ AAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKF
Database link: P43243 -
Positive control
- WB: RT$ and U-251 MG whole cell lysates. IHC-P: Human gall bladder tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab246997 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.4 µg/ml. Predicted molecular weight: 95 kDa. | |
| IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. In association with the SFPQ-NONO heteromer may play a role in nuclear retention of defective RNAs. -
Involvement in disease
Defects in MATR3 are the cause of myopathy distal type 2 (MPD2) [MIM:606070]; also called vocal cord and pharyngeal dysfunction with distal myopathy (VCPDM). MPD2 is a muscular disorder characterized by distal weakness, with onset in hands and feet, associated with vocal cord and pharyngeal weakness causing a nasal voice and swallowing disorders. -
Sequence similarities
Contains 1 matrin-type zinc finger.
Contains 2 RRM (RNA recognition motif) domains. -
Cellular localization
Nucleus matrix. - Information by UniProt
-
Database links
- Entrez Gene: 9782 Human
- Entrez Gene: 17184 Mouse
- Entrez Gene: 29150 Rat
- Omim: 164015 Human
- SwissProt: P43243 Human
- SwissProt: Q8K310 Mouse
- SwissProt: P43244 Rat
- Unigene: 268939 Human
see all -
Alternative names
- ALS21 antibody
- KIAA0723 antibody
- Matr3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Matrin 3 antibody (ab246997)Paraffin-embedded human gall bladder tissue stained for Matrin 3 using ab246997 at 1/20 dilution in immunohistochemical analysis. -
Western blot - Anti-Matrin 3 antibody (ab246997)All lanes : Anti-Matrin 3 antibody (ab246997) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 95 kDa
Datasheets and documents
References
ab246997 has not yet been referenced specifically in any publications.
