Anti-Matrin 3 antibody (ab246997)
Key features and details
- Rabbit polyclonal to Matrin 3
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Matrin 3 antibody
See all Matrin 3 primary antibodies -
Description
Rabbit polyclonal to Matrin 3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human Matrin 3 aa 399-488.
Sequence:VVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQ AAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKF
Database link: P43243 -
Positive control
- WB: RT$ and U-251 MG whole cell lysates. IHC-P: Human gall bladder tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab246997 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 95 kDa. | |
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. In association with the SFPQ-NONO heteromer may play a role in nuclear retention of defective RNAs. -
Involvement in disease
Defects in MATR3 are the cause of myopathy distal type 2 (MPD2) [MIM:606070]; also called vocal cord and pharyngeal dysfunction with distal myopathy (VCPDM). MPD2 is a muscular disorder characterized by distal weakness, with onset in hands and feet, associated with vocal cord and pharyngeal weakness causing a nasal voice and swallowing disorders. -
Sequence similarities
Contains 1 matrin-type zinc finger.
Contains 2 RRM (RNA recognition motif) domains. -
Cellular localization
Nucleus matrix. - Information by UniProt
-
Database links
- Entrez Gene: 9782 Human
- Entrez Gene: 17184 Mouse
- Entrez Gene: 29150 Rat
- Omim: 164015 Human
- SwissProt: P43243 Human
- SwissProt: Q8K310 Mouse
- SwissProt: P43244 Rat
- Unigene: 268939 Human
see all -
Alternative names
- ALS21 antibody
- KIAA0723 antibody
- Matr3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Matrin 3 antibody (ab246997)Paraffin-embedded human gall bladder tissue stained for Matrin 3 using ab246997 at 1/20 dilution in immunohistochemical analysis.
-
All lanes : Anti-Matrin 3 antibody (ab246997) at 0.4 µg/ml
Lane 1 : RT4 (human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
Predicted band size: 95 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246997 has not yet been referenced specifically in any publications.