Overview

  • Product name

  • Description

    Rabbit polyclonal to MAZ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MAZ aa 383-435.
    Sequence:

    AHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVC PMA


    Database link: P56270

  • Positive control

    • MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May function as a transcription factor with dual roles in transcription initiation and termination. Binds to two sites, ME1a1 and ME1a2, within the MYC promoter having greater affinity for the former. Also binds to multiple G/C-rich sites within the promoter of the Sp1 family of transcription factors.
  • Tissue specificity

    Present in kidney, liver and brain. In the brain, highest levels are found in motor cortex and midfrontal cortex (at protein level).
  • Sequence similarities

    Contains 6 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus. In brains of Alzheimer disease patients, present in a plaque-like structures.
  • Information by UniProt
  • Database links

  • Alternative names

    • MAZ antibody
    • MAZ_HUMAN antibody
    • MAZI antibody
    • MYC associated zinc finger protein antibody
    • Myc-associated zinc finger protein antibody
    • Pur-1 antibody
    • Pur1 antibody
    • Purine binding transcription factor antibody
    • Purine-binding transcription factor antibody
    • SAF 1 antibody
    • SAF 2 antibody
    • SAF-1 antibody
    • SAF-2 antibody
    • SAF-3 antibody
    • Serum amyloid A activating factor 1 antibody
    • Serum amyloid A activating factor 2 antibody
    • Transcription factor Zif87 antibody
    • ZF87 antibody
    • Zif87 antibody
    • Zinc finger protein 801 antibody
    • Zinc finger protein, 87 kilodaltons antibody
    • ZNF801 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling MAZ with ab221464 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up