Overview

  • Product name

    Anti-MBD3L1 antibody - N-terminal
  • Description

    Rabbit polyclonal to MBD3L1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MBD3L1 aa 1-81 (N terminal).
    Sequence:

    MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEV RYHQWEESLEKPQQVCWQRRLQGLQAYSSAG


    Database link: Q8WWY6

  • Positive control

    • Human testis tissue, U-251MG sp lysate and A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab187902 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

WB 1/100 - 1/250. Predicted molecular weight: 22 kDa.

Target

  • Function

    Transcriptional repressor.
  • Tissue specificity

    Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested.
  • Sequence similarities

    Belongs to the MBD3L family.
  • Domain

    The N-terminal half of the protein mediates transcription repression.
  • Cellular localization

    Nucleus. Nuclear, in large foci.
  • Information by UniProt
  • Database links

  • Alternative names

    • MB3L1_HUMAN antibody
    • MBD3 like 1 antibody
    • MBD3-like protein 1 antibody
    • MBD3L antibody
    • Mbd3l1 antibody
    • Methyl CpG binding domain protein 3 like 1 antibody
    • Methyl-CpG-binding domain protein 3-like 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Human testis tissue labeling MBD3L1 with ab187902 antibody at a dilution of 1/200.

  • All lanes : Anti-MBD3L1 antibody - N-terminal (ab187902) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251MG sp cell lysate

    Predicted band size: 22 kDa

  • Immunofluorescent analysis of A431 cells labeling MBD3L1 with ab187902 at 4 µg/ml.

References

ab187902 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187902.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up