Overview

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: PBS, pH 7.2
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab103144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 160 kDa.

Target

  • Function
    Binds to heterochromatin. Does not interact with either methylated or unmethylated DNA (in vitro).
  • Tissue specificity
    Detected in heart, placenta, liver, skeletal muscle, kidney and pancreas.
  • Involvement in disease
    Defects in MBD5 are the cause of mental retardation autosomal dominant type 1 (MRD1) [MIM:156200]. Mental retardation is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period.
  • Sequence similarities
    Contains 1 MBD (methyl-CpG-binding) domain.
    Contains 1 PWWP domain.
  • Domain
    Both MBD and PWWP domains are necessary for chromocentric localization.
  • Cellular localization
    Nucleus. Chromosome. Associated with pericentric heterochromatin and Nucleus. Not associated with pericentric heterochromatin.
  • Information by UniProt
  • Database links
  • Alternative names
    • 9430004D19Rik antibody
    • AA536666 antibody
    • AI426407 antibody
    • C030040A15Rik antibody
    • FLJ11113 antibody
    • FLJ30517 antibody
    • KIAA1461 antibody
    • MBD5 antibody
    • MBD5_HUMAN antibody
    • methyl CpG binding domain protein 5 antibody
    • Methyl CpG binding protein MBD5 antibody
    • Methyl-CpG-binding domain protein 5 antibody
    • Methyl-CpG-binding protein MBD5 antibody
    • RP23 167N13.1 antibody
    see all

Images

  • Anti-MBD5 antibody (ab103144) at 5 µg/ml + Human liver lysate at 50 µg

    Predicted band size: 160 kDa

  • Anti-MBD5 antibody (ab103144) at 5 µg/ml + HepG2 cell lysate at 50 µg

    Predicted band size: 160 kDa

References

ab103144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting Abcam regarding ab103144.


Regarding the immunogen sequence, the antibody was raised against aa623-840 of MBD5. The sequence can be found in UniProt entry Q9P267.

MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQSQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPGCGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSNSPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTPVIPNS
IVSSYNQTSSEAGMVLLEKSTQRY


I hope this information is helpful and I apologize for any confusion caused. Please do not hesitate to contact me if you have any additional questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up