Overview

  • Product name

  • Description

    Rabbit polyclonal to MBNL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MBNL2 aa 95-144.
    Sequence:

    AMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPGVGLV


    Database link: Q5VZF2

  • Positive control

    • ICC/IF: SK-MEL-30 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. RNA-binding protein that binds to 5'ACACCC-3' core sequence, termed zipcode, within the 3'UTR of ITGA3. Binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. Seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm at adhesion plaques. May play a role in myotonic dystrophy pathophysiology (DM).
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the muscleblind family.
    Contains 4 C3H1-type zinc fingers.
  • Cellular localization

    Nucleus. Cytoplasm. Greater concentration in the nucleus. Expressed in or near large cytoplasmic adhesion plaques (PubMed:16273094). Location in the cytoplasm is microtubule-dependent (PubMed:16273094). In both DM1 and DM2 patients, colocalizes with nuclear foci of retained expanded-repeat transcripts (PubMed:11929853).
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781H1296 antibody
    • MBLL antibody
    • MBLL39 antibody
    • Mbnl2 antibody
    • MBNL2_HUMAN antibody
    • MGC120625 antibody
    • MGC120626 antibody
    • MGC120628 antibody
    • Muscleblind like 2 antibody
    • muscleblind like protein 1 antibody
    • muscleblind like protein 2 antibody
    • muscleblind like protein like 39 antibody
    • muscleblind like splicing regulator 2 antibody
    • Muscleblind-like protein 1 antibody
    • Muscleblind-like protein 2 antibody
    • Muscleblind-like protein-like 39 antibody
    • Muscleblind-like protein-like antibody
    • OTTHUMP00000178763 antibody
    • PRO2032 antibody
    • RP11-128N14.1 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized SK-MEL-30 cells stained for MBNL2 (green) using ab222242 at 4 µg/ml in ICC/IF.

References

ab222242 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Rat Cell (Cortical Neuronal Cell)
Permeabilization
Yes - 0.3% Triton X-100
Specification
Cortical Neuronal Cell
Blocking step
Goat Serum as blocking agent for 20 minute(s) · Concentration: 4% · Temperature: 23°C
Fixative
Paraformaldehyde

Miss. Karishma Joshi

Verified customer

Submitted Jun 29 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up