Anti-MC2-R antibody (ab180793)
Key features and details
- Rabbit polyclonal to MC2-R
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MC2-R antibody
See all MC2-R primary antibodies -
Description
Rabbit polyclonal to MC2-R -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant full length protein corresponding to Human MC2-R aa 1-297.
Sequence:MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVF KNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFET TADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVV LTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLA RSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPY CACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
Database link: Q01718 -
Positive control
- 293 cell lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180793 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/1000 - 1/2000. Predicted molecular weight: 34 kDa.
|
Notes |
---|
WB
1/1000 - 1/2000. Predicted molecular weight: 34 kDa. |
Target
-
Function
Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase. -
Tissue specificity
Melanocytes and corticoadrenal tissue. -
Involvement in disease
Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1) [MIM:202200]; also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency. -
Sequence similarities
Belongs to the G-protein coupled receptor 1 family. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 4158 Human
- Entrez Gene: 17200 Mouse
- Omim: 607397 Human
- SwissProt: Q01718 Human
- SwissProt: Q64326 Mouse
- Unigene: 248144 Human
- Unigene: 426053 Mouse
-
Alternative names
- ACTH receptor antibody
- ACTH-R antibody
- ACTHR antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab180793 has been referenced in 1 publication.
- Maisto R et al. ARPE-19-derived VEGF-containing exosomes promote neovascularization in HUVEC: the role of the melanocortin receptor 5. Cell Cycle 18:413-424 (2019). PubMed: 30739530