Overview

  • Product name

  • Description

    Rabbit polyclonal to MC2-R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MC2-R aa 1-297.
    Sequence:

    MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVF KNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFET TADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVV LTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLA RSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPY CACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW


    Database link: Q01718

  • General notes

    Protein previously labeled as MC2 receptor.

Properties

Applications

Our Abpromise guarantee covers the use of ab193551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 34 kDa.

Target

  • Function

    Receptor for ACTH. This receptor is mediated by G proteins (G(s)) which activate adenylate cyclase.
  • Tissue specificity

    Melanocytes and corticoadrenal tissue.
  • Involvement in disease

    Defects in MC2R are the cause of glucocorticoid deficiency type 1 (GCCD1) [MIM:202200]; also known as familial glucocorticoid deficiency type 1 (FGD1). GCCD1 is an autosomal recessive disorder due to congenital insensitivity or resistance to adrenocorticotropin (ACTH). It is characterized by progressive primary adrenal insufficiency, without mineralocorticoid deficiency.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ACTH receptor antibody
    • ACTH-R antibody
    • ACTHR antibody
    • ACTHR_HUMAN antibody
    • Adrenocorticotropic hormone receptor antibody
    • Adrenocorticotropin receptor antibody
    • Corticotropin receptor antibody
    • MC2 receptor antibody
    • MC2-R antibody
    • MC2R antibody
    • Melanocortin 2 receptor (adrenocorticotropic hormone) antibody
    • Melanocortin 2 receptor antibody
    • Melanocortin receptor 2 antibody
    see all

References

ab193551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up