Overview

  • Product name

    Anti-MCART1 antibody
  • Description

    Rabbit polyclonal to MCART1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human MCART1 aa 1-35.
    Sequence:

    MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYL


    Database link: Q9H1U9

  • Positive control

    • WB: Mouse kidney lysate. ICC/IF: HEK-293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-MCART1 antibody (ab237054) at 1/1000 dilution + Mouse kidney tssue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution
  • HEK-293 (Human epithelial cell line from embryonic kidney) cells stained for MCART1 (green) using ab237054 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488-conjugated goat anti-rabbit IgG (H+L).

References

ab237054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up