Overview

  • Product name

    Anti-MCCC1 antibody
  • Description

    Rabbit polyclonal to MCCC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human MCCC1 aa 522-696. Genbank: BC004187
    Sequence:

    MTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHD GSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLF SKEGSIEIDIPVPKYLSSVSSQETQGGPLAPMTGTIEKVFVKAGDKVKAG DSLMVMIAMKMEHTIKSPKDGTVKK


    Database link: Q96RQ3

  • Positive control

    • 293T cell lysate and mouse heart lysate. Human fetal liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 80 kDa.
IHC-P 1/100 - 1/500.

Target

  • Relevance

    MCCC1 is the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Defects in MCCC1 are the cause of methylcrotonoyl-CoA carboxylase deficiency type 1 (MCC1 deficiency). MCC1 deficiency is an autosomal recessive disorder of leucine catabolism.
  • Cellular localization

    Mitochondrion matrix.
  • Database links

  • Alternative names

    • 3-methylcrotonyl-CoA carboxylase 1 antibody
    • 3-methylcrotonyl-CoA carboxylase biotin-containing subunit antibody
    • 3-methylcrotonyl-CoA carboxylase, alpha antibody
    • 3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha antibody
    • DKFZp686B20267 antibody
    • FLJ25545 antibody
    • MCC-B antibody
    • MCCA antibody
    • MCCase subunit alpha antibody
    • methylcrotonoyl-CoA carboxylase 1 (alpha) antibody
    • methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial antibody
    • methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) antibody
    see all

Images

  • All lanes : Anti-MCCC1 antibody (ab197282) at 1/500 dilution

    Lane 1 : 293 cell lysate
    Lane 2 : Mouse heart lysate

    Predicted band size: 80 kDa

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded human fetal liver tissue labeling MCCC1 with ab197282 at a 1/100 dilution.

References

This product has been referenced in:

  • Sacoman JL  et al. Mitochondrial O-GlcNAc Transferase (mOGT) Regulates Mitochondrial Structure, Function, and Survival in HeLa Cells. J Biol Chem 292:4499-4518 (2017). Read more (PubMed: 28100784) »
See 1 Publication for this product

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Tissue lysate - whole (mouse organs (see image))
Gel Running Conditions
Reduced Denaturing
Loading amount
20 µg
Specification
mouse organs (see image)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Feb 22 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up