Overview

  • Product name

    Anti-MCF2L2/DRG antibody
  • Description

    Rabbit polyclonal to MCF2L2/DRG
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MCF2L2/DRG aa 539-626.
    Sequence:

    PHPESSPKWVSSKTSQPSTSVPLARPLRTSEEPYTETELNSRGKEDDETK FEVKSEEIFESHHERGNPELEQQARLGDLSPRRRIIRD


    Database link: Q86YR7

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: U-2 OS cells.
  • General notes

     This product was previously labelled as MCF2L2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243495 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probably functions as a guanine nucleotide exchange factor.
  • Tissue specificity

    Significantly expressed in brain and modestly in pancreas, brain and testis.
  • Involvement in disease

    Genetic variation in MCF2L2 may be associated with susceptibility to noninsulin-dependent diabetes mellitus (NIDDM) [MIM:125853]; also known as diabetes mellitus type 2.
  • Sequence similarities

    Belongs to the MCF2 family.
    Contains 1 CRAL-TRIO domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 spectrin repeat.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARHGEF22 antibody
    • Dbs related Rho family guanine nucleotide exchange factor antibody
    • Dbs-related Rho family guanine nucleotide exchange factor antibody
    • DKFZp686K0690 antibody
    • DRG antibody
    • FLJ42509 antibody
    • KIAA0861 antibody
    • MCF.2 cell line derived transforming sequence like 2 antibody
    • MCF2 transforming sequence like protein 2 antibody
    • MCF2-transforming sequence-like protein 2 antibody
    • MCF2L2 antibody
    • MF2L2_HUMAN antibody
    • Probable guanine nucleotide exchange factor MCF2L2 antibody
    • Rho family guanine nucleotide exchange factor antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for MCF2L2/DRG using ab243495 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for MCF2L2/DRG (green) using ab243495 at 4 µg/ml in ICC/IF.

References

ab243495 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243495.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up