Overview

  • Product name

    Anti-MCFD2 antibody
  • Description

    Rabbit polyclonal to MCFD2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human MCFD2 aa 31-119.
    Sequence:

    ASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMH DYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELIN


    Database link: Q8NI22

  • Positive control

    • Human salivary gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    The MCFD2-LMAN1 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins. Plays a role in the secretion of coagulation factors.
  • Involvement in disease

    Defects in MCFD2 are a cause of factor V and factor VIII combined deficiency type 2 (F5F8D2) [MIM:613625]; also known as multiple coagulation factor deficiency 2 (MCFD2). F5F8D2 is a blood coagulation disorder characterized by bleeding symptoms similar to those in hemophilia or parahemophilia, that are caused by single deficiency of FV or FVIII, respectively. The most common symptoms are epistaxis, menorrhagia, and excessive bleeding during or after trauma. Plasma levels of coagulation factors V and VIII are in the range of 5 to 30% of normal.
  • Sequence similarities

    Contains 2 EF-hand domains.
  • Domain

    Essentially unstructured in the absence of calcium ions. Requires calcium ions for folding.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment. Endoplasmic reticulum. Golgi apparatus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1810021C21Rik antibody
    • DKFZp686G21263 antibody
    • F5F8D antibody
    • LMAN1IP antibody
    • MCFD 2 antibody
    • Mcfd2 antibody
    • MCFD2_HUMAN antibody
    • Multiple coagulation factor deficiency protein 2 antibody
    • Neural stem cell derived neuronal survival protein antibody
    • Neural stem cell-derived neuronal survival protein antibody
    • SDNSF antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human salivary gland tissue labeling MCFD2 with ab203892 at 1/20 dilution.

References

ab203892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up