Overview

  • Product name

  • Description

    Rabbit polyclonal to MCM10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MCM10 aa 616-875.
    Sequence:

    RLEGAPATMTPKLGRGVLEGDDVLFYDESPPPRPKLSALAEAKKLAAITK LRAKGQVLTKTNPNSIKKKQKDPQDILEVKERVEKNTMFSSQAEDELEPA RKKRREQLAYLESEEFQKILKAKSKHTGILKEAEAEMQERYFEPLVKKEQ MEEKMRNIREVKCRVVTCKTCAYTHFKLLETCVSEQHEYHWHDGVKRFFK CPCGNRSISLDRLPNKHCSNCGLYKWERDGMLKEKTGPKIGGETLLPRGE EHAKFLNSLK


    Database link: Q7L590

  • Positive control

    • IHC-P: Human tonsil and spleen tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230109 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Acts as a replication initiation factor that brings together the MCM2-7 helicase and the DNA polymerase alpha/primase complex in order to initiate DNA replication. Additionally, plays a role in preventing DNA damage during replication.
  • Sequence similarities

    Belongs to the MCM10 family.
  • Developmental stage

    Expression is cell cycle regulated. Expression increases at the G1/S-boundary. Expression decreases in late M phase, remains low during G(1) phase, and starts to accumulate at the onset of S phase.
  • Domain

    The zinc finger-like domain binds a zinc ion and is involved in self-association.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Colocalizes with ORC2 in nuclei foci. Associated with chromatin in S phase. From early to mid-S phase located in discrete nuclear foci. In early S phase, several hundred foci appeared throughout the nucleus. In mid-S phase, the foci appeared at the nuclear periphery and nucleolar regions. In the late S and G phases localized to nucleoli.
  • Information by UniProt
  • Database links

  • Alternative names

    • CNA43 antibody
    • DNA43 antibody
    • FLJ31133 antibody
    • Homolog of yeast MCM10 antibody
    • HsMCM10 antibody
    • mcm10 antibody
    • MCM10 minichromosome maintenance deficient 10 antibody
    • MCM10_HUMAN antibody
    • Minichromosome maintenance 10 replication initiation factor antibody
    • Minichromosome maintenance complex component 10 antibody
    • Minichromosome maintenance protein 10 isoform 1 antibody
    • PRO2249 antibody
    • Protein MCM10 homolog antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for MCM10 using ab230109 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for MCM10 using ab230109 at 1/100 dilution in immunohistochemical analysis.

References

ab230109 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230109.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up