Overview

  • Product name

  • Description

    Rabbit polyclonal to MCM7/PRL
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MCM7/PRL aa 360-719. NP_005907.3
    Sequence:

    GGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGS SGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIH EVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPA ALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLM RRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAI LRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPAD VIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQV NASRTRITFV


    Database link: P33993-1

  • Positive control

    • WB: A549, HeLa, HL-60, MCF7 and SW480 cell extracts. ICC/IF: HeLa cells.
  • General notes

     This product was previously labelled as MCM7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238529 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 81 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.
  • Sequence similarities

    Belongs to the MCM family.
    Contains 1 MCM domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDABP0042 antibody
    • CDC 47 antibody
    • CDC47 antibody
    • CDC47 homolog antibody
    • Cdc47, S. cerevisiae, homolog of antibody
    • DNA replication licensing factor MCM7 antibody
    • Homolog of S. cerevisiae Cdc47 antibody
    • MCM 2 antibody
    • MCM 7 antibody
    • MCM2 antibody
    • MCM2, formerly antibody
    • Mcm7 antibody
    • MCM7 minichromosome maintenance deficient 7 antibody
    • MCM7_HUMAN antibody
    • Minichromosome Maintainence 7 antibody
    • Minichromosome maintainence, S. cerevisiae, homolog of antibody
    • Minichromosome maintenance complex component 7 antibody
    • Minichromosome maintenance deficient 7 antibody
    • Minichromosome maintenance protein 7 antibody
    • P1.1 MCM3 antibody
    • P1.1-MCM3 antibody
    • P1CDC47 antibody
    • P85MCM antibody
    • PNAS 146 antibody
    • PNAS146 antibody
    • PPP1R104 antibody
    • Protein phosphatase 1, regulatory subunit 104 antibody
    see all

Images

  • All lanes : Anti-MCM7/PRL antibody (ab238529) at 1/1000 dilution

    Lane 1 : A549 (Human lung carcinoma cell line) cell extracts
    Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell extracts
    Lane 3 : HL-60 (Human promyelocytic leukemia cell line) cell extracts
    Lane 4 : MCF7 (Human breast adenocarcinoma cell line) cell extracts
    Lane 5 : SW480 (Human colorectal adenocarcinoma cell line) cell extracts

    Lysates/proteins at 25 µg per lane.

    Secondary
    All lanes : HRP Goat Anti-Rabbit IgG (H+L) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 81 kDa


    Exposure time: 10 seconds


    Blocking buffer: 3% non-fat dry milk in TBST.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for MCM7/PRL using ab238529 (Top panel, green) at a 1/50 dilution in ICC/IF. Counterstained with DAPI (Bottom panel, merge).

References

ab238529 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238529.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up