Overview

  • Product name

    Anti-MCM7/PRL antibody - BSA and Azide free
    See all MCM7/PRL primary antibodies
  • Description

    Rabbit polyclonal to MCM7/PRL - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Hamster, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human MCM7/PRL aa 562-719 (C terminal).
    Sequence:

    YIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILR LSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVI FATVRELVS GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV


    Database link: P33993

  • Positive control

    • Human HeLa, SiHa, C33A, WI38 cell extracts; Mouse NIH 3T3 cell extract.
  • General notes

     This product was previously labelled as MCM7

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituents: 50% Glycerol, 50% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    ab179904 is filter-sterilised.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 81 kDa.
ICC/IF 1/200 - 1/1000.
IP Use at an assay dependent concentration.

Target

  • Function

    Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. Required for S-phase checkpoint activation upon UV-induced damage.
  • Sequence similarities

    Belongs to the MCM family.
    Contains 1 MCM domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CDABP0042 antibody
    • CDC 47 antibody
    • CDC47 antibody
    • CDC47 homolog antibody
    • Cdc47, S. cerevisiae, homolog of antibody
    • DNA replication licensing factor MCM7 antibody
    • Homolog of S. cerevisiae Cdc47 antibody
    • MCM 2 antibody
    • MCM 7 antibody
    • MCM2 antibody
    • MCM2, formerly antibody
    • Mcm7 antibody
    • MCM7 minichromosome maintenance deficient 7 antibody
    • MCM7_HUMAN antibody
    • Minichromosome Maintainence 7 antibody
    • Minichromosome maintainence, S. cerevisiae, homolog of antibody
    • Minichromosome maintenance complex component 7 antibody
    • Minichromosome maintenance deficient 7 antibody
    • Minichromosome maintenance protein 7 antibody
    • P1.1 MCM3 antibody
    • P1.1-MCM3 antibody
    • P1CDC47 antibody
    • P85MCM antibody
    • PNAS 146 antibody
    • PNAS146 antibody
    • PPP1R104 antibody
    • Protein phosphatase 1, regulatory subunit 104 antibody
    see all

Images

  • All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/1000 dilution

    Lane 1 : SiHa whole cell extract
    Lane 2 : C33A whole cell extract
    Lane 3 : WI38 whole cell extract

    Lysates/proteins at 100000 cells per lane.

    Predicted band size: 81 kDa

  • All lanes : Anti-MCM7/PRL antibody - BSA and Azide free (ab179904) at 1/2000 dilution

    Lane 1 : HeLa whole cell extract
    Lane 2 : HeLa whole cell extract treated with 100 nM adriamycin for 24 hours
    Lane 3 : NIH 3T3 whole cell extract

    Predicted band size: 81 kDa

  • Immunoprecipitation analysis on crude extracts of fibroblast cell line WI38 using ab179904. 

    Lane 1; Immunoprecipitation with pre-immune serum.

    Lane 2; Immnoprecipitation with ab179904 antiserum. 

    Cells were labeled with S35 methionine and MCM7/PRL was immunoprecipitated with ab179904 followed by SDS-PAGE and autoradiography.

  • Immunofluorecent staining and confocal microscopic analysis of formaldehyde-fixed G1 phase HeLa cell nucleus, labeling MCM7/PRL using ab179904 at 1/200 dilution, after treatment with protein cross-linking reagent, DSP and chromatin extraction.

References

This product has been referenced in:

  • Fujita M  et al. Nuclear organization of DNA replication initiation proteins in mammalian cells. J Biol Chem 277:10354-61 (2002). Read more (PubMed: 11779870) »
  • Fujita M  et al. In vivo interaction of human MCM heterohexameric complexes with chromatin. Possible involvement of ATP. J Biol Chem 272:10928-35 (1997). Read more (PubMed: 9099751) »
See all 3 Publications for this product

Customer reviews and Q&As

Application
Western blot
Sample
Saccharomyces cerevisiae Cell lysate - other (Samples are whole cell lysate and the related chro)
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris with MOPS buffer)
Loading amount
10 µg
Specification
Samples are whole cell lysate and the related chro
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C

Abcam user community

Verified customer

Submitted Apr 30 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up