Overview

  • Product name

    Anti-MCP2 antibody [17A2]
    See all MCP2 primary antibodies
  • Description

    Rat monoclonal [17A2] to MCP2
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse MCP2 aa 20-96.
    Sequence:

    MKIYAVLLCLLLIAVPVSPEKLTGPDKAPVTCCFHVLKLKIPLRVLKSYE RINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP


    Database link: Q9Z121

Properties

Applications

Our Abpromise guarantee covers the use of ab194596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 11 kDa.

Target

  • Function

    Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils. May play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not show monocyte chemotactic activity, but inhibits the chemotactic effect most predominantly of CCL7, and also of CCL2 and CCL5 and CCL8.
  • Tissue specificity

    Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-terminal processed form MCP-2(6-76) is produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ccl8 antibody
    • CCL8_HUMAN antibody
    • HC14 antibody
    • MCP-2 antibody
    • MCP-2(6-76) antibody
    • Monocyte chemoattractant protein 2 antibody
    • Monocyte chemotactic protein 2 antibody
    • SCYA10 antibody
    • SCYA8 antibody
    • Small-inducible cytokine A8 antibody
    see all

References

ab194596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up