Overview

  • Product name

  • Description

    Rabbit polyclonal to MCP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MCP4 aa 17-81.
    Sequence:

    ALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICAD PKEKW


    Database link: Q99616

  • Positive control

    • IHC: Human lung tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224593 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Chemotactic factor that attracts monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. Signals through CCR2B and CCR3 receptors. Plays a role in the accumulation of leukocytes at both sides of allergic and non-allergic inflammation. May be involved in the recruitment of monocytes into the arterial wall during the disease process of atherosclerosis. May play a role in the monocyte attraction in tissues chronically exposed to exogenous pathogens.
  • Tissue specificity

    Widely expressed. Found in small intestine, thymus, colon, lung, trachea, stomach and lymph node. Low levels seen in the pulmonary artery smooth muscle cells.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    One major form (form long), and two minor forms (short chain and medium chain) are produced by differential signal peptide cleavage. The medium chain is about 30-fold less active than the long chain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-C motif chemokine 13 antibody
    • CCL13 antibody
    • CCL13_HUMAN antibody
    • Chemokine (C C motif) ligand 13 antibody
    • CK beta 10 antibody
    • CK-beta-10 antibody
    • CKb10 antibody
    • MCP-4 antibody
    • MGC17134 antibody
    • Monocyte chemoattractant protein 4 antibody
    • Monocyte chemotactic protein 4 antibody
    • NCC 1 antibody
    • NCC-1 antibody
    • NCC1 antibody
    • New CC chemokine 1 antibody
    • SCYA13 antibody
    • SCYL1 antibody
    • short chain antibody
    • Small inducible cytokine A13 precursor antibody
    • Small inducible cytokine subfamily A (Cys Cys) member 13 antibody
    • Small-inducible cytokine A13 antibody
    see all

Images

  • Paraffin-embedded human lung tissue tissue stained for MCP4 using ab224593 at 1/100 dilution in immunohistochemical analysis.

References

ab224593 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224593.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up