Anti-MCPIP1 antibody [MM1044-23Z18] - C-terminal (ab211659)

Overview

  • Product name

    Anti-MCPIP1 antibody [MM1044-23Z18] - C-terminal
    See all MCPIP1 primary antibodies
  • Description

    Mouse monoclonal [MM1044-23Z18] to MCPIP1 - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human MCPIP1 aa 426-599 (C terminal).
    Sequence:

    DSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYG SELPATAAFSAFGRAMGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPT SVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGR FPQLLDPQQLAAEILSYKSQHPSE


    Database link: Q5D1E8

  • Positive control

Properties

Applications

Our Abpromise guarantee covers the use of ab211659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 66 kDa.

Target

  • Function

    Has RNase activity and selectively degrades specific target mRNA species. Modulates the immune response and inflammation by regulating the decay of specific mRNA molecules. Recognizes the 3'-untranslated region (UTR) of the mRNA for IL6, CALCR and IL12B. Required for normal decay of IL6 mRNA (By similarity). Triggers apoptosis and promotes angiogenesis in response to the binding of CCL2 to CCR2. Regulates expression of CDH12 and CHD19.
  • Sequence similarities

    Belongs to the ZC3H12 family.
    Contains 1 C3H1-type zinc finger.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • dJ423B22.1 antibody
    • MCP 1 treatment-induced protein antibody
    • MCP-induced protein 1 antibody
    • MCP1-induced protein antibody
    • MCPIP 1 antibody
    • MCPIP antibody
    • Ribonuclease ZC3H12A antibody
    • RP3-423B22.1 antibody
    • ZC12A_HUMAN antibody
    • ZC3H 12A antibody
    • ZC3H12 A antibody
    • Zc3h12a antibody
    • Zinc finger CCCH domain-containing protein 12A antibody
    • Zinc finger CCCH type containing 12A antibody
    see all

Images

  • Anti-MCPIP1 antibody [MM1044-23Z18] - C-terminal (ab211659) at 1/1000 dilution + HeLa cell lysate

    Predicted band size: 66 kDa

References

ab211659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up