Overview

  • Product name

  • Description

    Rabbit polyclonal to MCRS1/MSP58
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human MCRS1/MSP58 aa 238-331.
    Sequence:

    HPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDL IDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVD


    Database link: Q96EZ8

  • Positive control

    • IHC-P: Human testis tissue. WB: NIH/3T3, NBT-II and RT4 cell lysate. ICC/IF: MCF7 cells.
  • General notes

     This product was previously labelled as MCRS1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab247013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Modulates the transcription repressor activity of DAXX by recruiting it to the nucleolus. May be an inhibitor of TERT telomerase activity.
    Putative regulatory component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
  • Tissue specificity

    Detected in testis, and at lower levels in spleen, thymus, prostate, uterus, small intestine, colon and leukocytes.
  • Sequence similarities

    Contains 1 FHA domain.
  • Developmental stage

    Cell-cycle regulated: levels are highest early in S phase; not detectable in G2.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. In microspherules in the nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 58 kDa microspherule protein antibody
    • Cell cycle regulated factor (78 kDa) antibody
    • Cell cycle regulated factor p78 antibody
    • Cell cycle-regulated factor p78 antibody
    • ICP22BP antibody
    • INO80 complex subunit J antibody
    • MCRS 1 antibody
    • MCRS 2 antibody
    • MCRS1 antibody
    • MCRS1_HUMAN antibody
    • MCRS2 antibody
    • Microspherule protein 1 antibody
    • MSP 58 antibody
    • MSP58 antibody
    • p78 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized MCF7 (Human breast adenocarcinoma cell line) cells labeling MCRS1/MSP58 using ab247013 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human testis tissue stained for MCRS1/MSP58 using ab247013 at 1/1000 dilution in immunohistochemical analysis.

  • Anti-MCRS1/MSP58 antibody (ab247013) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate
  • All lanes : Anti-MCRS1/MSP58 antibody (ab247013) at 0.4 µg/ml

    Lane 1 : NIH/3T3 (Mouse embryo fibroblast cell line) cell lysate
    Lane 2 : NBT-II (Rat cell line) cell lysate

References

ab247013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab247013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up