Overview

  • Product name

    Anti-MCSF Receptor antibody [RM0472-7M2]
    See all MCSF Receptor primary antibodies
  • Description

    Rat monoclonal [RM0472-7M2] to MCSF Receptor
  • Host species

    Rat
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Mouse MCSF Receptor aa 20-511.
    Sequence:

    APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTL TTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVE GQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKV LDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEA AQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVD FQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSL ILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRV KASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDV SGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQ LPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES


    Database link: P09581

  • Positive control

    • WB: Mouse spleen tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab205655 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 109 kDa.

Target

  • Function

    Protein tyrosine-kinase transmembrane receptor for CSF1 and IL34.
  • Tissue specificity

    Expressed in bone marrow and in differentiated blood mononuclear cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C FMS antibody
    • CD 115 antibody
    • CD115 antibody
    • CD115 antigen antibody
    • CFMS antibody
    • Colony stimulating factor 1 receptor antibody
    • Colony stimulating factor I receptor antibody
    • CSF 1 R antibody
    • CSF 1R antibody
    • CSF-1 receptor antibody
    • CSF-1-R antibody
    • CSF1 R antibody
    • CSF1R antibody
    • CSF1R_HUMAN antibody
    • CSFR antibody
    • EC 2.7.10.1 antibody
    • FIM 2 antibody
    • FIM2 antibody
    • FMS antibody
    • FMS proto oncogene antibody
    • FMS protooncogene antibody
    • HDLS antibody
    • M-CSF Receptor antibody
    • M-CSF-R antibody
    • Macrophage colony stimulating factor 1 receptor antibody
    • Macrophage colony stimulating factor I receptor antibody
    • Macrophage colony-stimulating factor 1 receptor antibody
    • McDonough feline sarcoma viral (v fms) oncogene homolog antibody
    • MCSFR antibody
    • Oncogen FMS antibody
    • Proto-oncogene c-Fms antibody
    • V-FMS McDonough feline sarcoma viral oncogen homolog, formerly antibody
    see all

Images

  • Anti-MCSF Receptor antibody [RM0472-7M2] (ab205655) at 1/1000 dilution + mouse spleen tissue lysate

    Predicted band size: 109 kDa

References

ab205655 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205655.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up