Overview

  • Product name

    Anti-MCU antibody [CL3576]
    See all MCU primary antibodies
  • Description

    Mouse monoclonal [CL3576] to MCU
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human MCU aa 285-349.
    Sequence:

    TRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRL RDPLQVHLPLRQIGE


    Database link: Q8NE86

  • Epitope

    Binds to an epitope located within the peptide sequence RDRQYLLFFH as determined by overlapping synthetic peptides.
  • Positive control

    • A549 cell extracts; A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 40 kDa.

Target

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized A549 cells labeling MCU with ab219827 at 4 µg/ml (green). Microtubule- and nuclear probes are visualized in red and blue, respectively.

  • Anti-MCU antibody [CL3576] (ab219827) at 1/500 dilution + A549 cell extract

    Predicted band size: 40 kDa

  • All lanes : Anti-MCU antibody [CL3576] (ab219827) at 1/500 dilution

    Lane 1 : A549 transfected with control siRNA cell extract
    Lane 2 : A549 transfected with target specific siRNA #1 cell extract
    Lane 3 : A549 transfected with target specific siRNA #2 cell extract

    Predicted band size: 40 kDa



    Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative to the control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.

References

ab219827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Zebrafish Tissue lysate - whole (Brain, heart, liver, retina, RPE)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
Specification
Brain, heart, liver, retina, RPE
Blocking step
Licor Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 24 2017

Application
Western blot
Sample
Mouse Tissue lysate - whole (Brain, heart, liver, skeletal muscle, retina)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
Specification
Brain, heart, liver, skeletal muscle, retina
Blocking step
Licor Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 24 2017

Application
Western blot
Sample
Human Cell lysate - whole cell (HEK cells)
Gel Running Conditions
Reduced Denaturing (12% gel)
Loading amount
20 µg
Specification
HEK cells
Blocking step
Licor Odyssey Blocking Buffer as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Jul 24 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up