Overview

  • Product name

  • Description

    Rabbit polyclonal to MDA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MDA5 aa 1-205. NP_071451.2
    Sequence:

    MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTV ATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELT DLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRN RIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGS DCSES


    Database link: Q9BYX4

  • Positive control

    • IHC-P: Human colon carcinoma and esophageal cancer tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab238526 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    RNA helicase that, through its ATP-dependent unwinding of RNA, may function to promote message degradation by specific RNases. Seems to have growth suppressive properties. Involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). ATPase activity is specifically induced by dsRNA. Essential for the production of interferons in response to picornaviruses.
  • Tissue specificity

    Widely expressed, at a low level. Expression is detected at slightly highest levels in placenta, pancreas and spleen and at barely levels in detectable brain, testis and lung.
  • Involvement in disease

    Genetic variation in IFIH1 is associated with diabetes mellitus insulin-dependent type 19 (IDDM19) [MIM:610155]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
    Note=IFIH1 is the CADM-140 autoantigen, involved in clinically amyopathic dermatomyositis (CADM). This is a chronic inflammatory disorder that shows typical skin manifestations of dermatomyositis but has no or little evidence of clinical myositis. Anti-CADM-140 antibodies appear to be specific to dermatomyositis, especially CADM. Patients with anti-CADM-140 antibodies frequently develop life-threatening acute progressive interstitial lung disease (ILD).
  • Sequence similarities

    Belongs to the helicase family.
    Contains 2 CARD domains.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Post-translational
    modifications

    During apoptosis, processed into 3 cleavage products. The helicase-containing fragment, once liberated from the CARD domains, translocate from the cytoplasm to the nucleus. The processed protein significantly sensitizes cells to DNA degradation.
  • Cellular localization

    Cytoplasm. Nucleus. May be found in the nucleus, during apoptosis.
  • Information by UniProt
  • Database links

  • Alternative names

    • CADM-140 autoantigen antibody
    • Clinically amyopathic dermatomyositis autoantigen 140 kDa antibody
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide antibody
    • DEAD/H box polypeptide antibody
    • Helicard antibody
    • Helicase with 2 CARD domains antibody
    • Hlcd antibody
    • IDDM 19 antibody
    • IDDM19 antibody
    • IFIH 1 antibody
    • Ifih1 antibody
    • IFIH1_HUMAN antibody
    • Interferon induced helicase C domain containing protein 1 antibody
    • interferon induced with helicase C domain 1 antibody
    • Interferon induced with helicase C domain protein 1 antibody
    • Interferon-induced helicase C domain-containing protein 1 antibody
    • Interferon-induced with helicase C domain protein 1 antibody
    • MDA 5 antibody
    • MDA-5 antibody
    • Melanoma differentiation associated protein 5 antibody
    • Melanoma differentiation-associated gene 5 antibody
    • Melanoma differentiation-associated protein 5 antibody
    • MGC133047 antibody
    • Murabutide down regulated protein antibody
    • Murabutide down-regulated protein antibody
    • RH 116 antibody
    • RH116 antibody
    • RIG I like receptor 2 antibody
    • RLR 2 antibody
    • RNA helicase DEAD box protein 116 antibody
    • RNA helicase-DEAD box protein 116 antibody
    see all

Images

  • U-2 OS (Human bone osteosarcoma epithelial cell line) cells stained for MDA5 using ab238526 (Top panel, red) at a 1/50 dilution in ICC/IF. Counterstained with DAPI (Bottom panel, merge).

  • Paraffin-embedded human colon carcinoma tissue stained for MDA5 with ab238526 at a 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human esophageal cancer tissue stained for MDA5 with ab238526 at a 1/200 dilution in immunohistochemical analysis.

References

ab238526 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238526.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up