Overview

  • Product name

  • Description

    Rabbit polyclonal to MDMX/MDM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MDMX/MDM4 aa 89-159.
    Sequence:

    SFSVKDPSPLYDMLRKNLVTLATATTDAAQTLALAQDHSMDIPSQDQLKQ SAEESSTSRKRTTEDDIPTLP


    Database link: O15151

  • Positive control

    • IHC-P: Human testis tissue.
  • General notes

     This product was previously labelled as MDMX

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244366 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions.
  • Tissue specificity

    Expressed in all tissues tested with high levels in thymus.
  • Sequence similarities

    Belongs to the MDM2/MDM4 family.
    Contains 1 RanBP2-type zinc finger.
    Contains 1 RING-type zinc finger.
    Contains 1 SWIB domain.
  • Domain

    Region I is sufficient for binding TP53 and inhibiting its G1 arrest and apoptosis functions. It also binds TP73. Region II contains most of a central acidic region and a putative C4-type zinc finger. The RING finger domain which coordinates two molecules of zinc mediates the heterooligomerization with MDM2.
  • Post-translational
    modifications

    Ubiquitinated. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp781B1423 antibody
    • Double minute 4 antibody
    • Double minute 4 human homolog of p53 binding protein antibody
    • Double minute 4 protein antibody
    • HDMX antibody
    • MDM 4 antibody
    • Mdm2 like p53 binding protein antibody
    • Mdm2-like p53-binding protein antibody
    • MDM4 antibody
    • Mdm4 p53 binding protein homolog mouse antibody
    • Mdm4 protein antibody
    • MDM4 related protein 1 antibody
    • Mdm4 transformed 3T3 cell double minute 4 antibody
    • Mdm4 transformed 3T3 cell double minute 4 p53 binding protein antibody
    • Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse antibody
    • MDM4_HUMAN antibody
    • Mdmx protein antibody
    • MGC132766 antibody
    • Mouse double minute 4 homolog antibody
    • Mouse double minute 4 human homolog of p53 binding protein antibody
    • MRP 1 antibody
    • MRP1 antibody
    • p53 binding protein antibody
    • p53 BINDING PROTEIN MDM4 antibody
    • p53-binding protein Mdm4 antibody
    • Protein Mdm4 antibody
    • Protein Mdmx antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human testis tissue stained for MDMX/MDM4 with ab244366 at a 1/50 dilution in immunohistochemical analysis.

References

ab244366 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244366.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up