Overview

  • Product name

  • Description

    Rabbit polyclonal to ME2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ME2 aa 296-424.
    Sequence:

    KVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFD KYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGA GRLFTPDVIRAMASINERPVIFALSNPTA


    Database link: P23368

  • Positive control

    • IHC: Human endometrial cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab222850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Belongs to the malic enzymes family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Malate dehydrogenase antibody
    • Malic enzyme 2 antibody
    • Malic enzyme 2 mitochondrial antibody
    • Malic enzyme 2 NAD(+) dependent mitochondrial antibody
    • Malic enzyme mitochondrial antibody
    • Malic enzyme NAD(+) dependent mitochondrial antibody
    • MAOM_HUMAN antibody
    • ME 2 antibody
    • ME2 antibody
    • mitochondrial antibody
    • NAD dependent malic enzyme mitochondrial antibody
    • NAD ME antibody
    • NAD-dependent malic enzyme antibody
    • NAD-ME antibody
    • ODS1 antibody
    • Pyruvic malic carboxylase antibody
    see all

Images

  • Paraffin-embedded human endometrial cancer tissue stained for ME2 using ab222850 at 1/100 dilution in immunohistochemical analysis.

References

ab222850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up