Overview

  • Product name

  • Description

    Rabbit polyclonal to ME2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human ME2 aa 220-426. Expressed in E. coli. N-terminal tags.
    Sequence:

    GLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKY REKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGI ANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSA PESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFAL SNPTAQA


    Database link: P23368

  • Positive control

    • WB: Recombinant human ME2 protein; Human lung tissue lysate; Jurkat, K562 and HeLa whole cell lysate (ab150035). IHC-P: Human cerebrum, liver, glioma, stomach, kidney and pancreatic cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab233509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Sequence similarities

    Belongs to the malic enzymes family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • Malate dehydrogenase antibody
    • Malic enzyme 2 antibody
    • Malic enzyme 2 mitochondrial antibody
    • Malic enzyme 2 NAD(+) dependent mitochondrial antibody
    • Malic enzyme mitochondrial antibody
    • Malic enzyme NAD(+) dependent mitochondrial antibody
    • MAOM_HUMAN antibody
    • ME 2 antibody
    • ME2 antibody
    • mitochondrial antibody
    • NAD dependent malic enzyme mitochondrial antibody
    • NAD ME antibody
    • NAD-dependent malic enzyme antibody
    • NAD-ME antibody
    • ODS1 antibody
    • Pyruvic malic carboxylase antibody
    see all

Images

  • All lanes : Anti-ME2 antibody (ab233509) at 1 µg/ml

    Lane 1 : Human lung tissue lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow ) whole cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution
  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for ME2 using ab233509 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human liver tissue stained for ME2 using ab233509 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human glioma tissue stained for ME2 using ab233509 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for ME2 using ab233509 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for ME2 using ab233509 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for ME2 using ab233509 at 20 μg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

     

  • Anti-ME2 antibody (ab233509) at 2 µg/ml + Recombinant human ME2 protein

References

ab233509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up