Overview

  • Product name

  • Description

    Rabbit polyclonal to ME3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human ME3 aa 547-598.
    Sequence:

    RIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPK EA


    Database link: Q16798

  • Positive control

    • WB; Mouse kidney and brain lysates. IHC-P: Human adrenal gland and thyroid tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab222857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/5000. Detects a band of approximately 68 kDa (predicted molecular weight: 67 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+) dependent isoform, and a mitochondrial NAD(+) dependent isoform. This gene encodes a mitochondrial NADP(+) dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. ME3 is expressed predominantly in organs with a low division rate. Its catalytic activity is (S) malate + NADP+ = pyruvate + CO2 + NADPH.
  • Cellular localization

    Mitochondrion matrix.
  • Database links

  • Alternative names

    • Malate dehydrogenase antibody
    • Malic enzyme 3 antibody
    • Malic enzyme 3, NADP(+) dependent, mitochondrial antibody
    • NADP ME antibody
    • NADPME antibody
    • Pyruvic malic carboxylase antibody
    see all

Images

  • All lanes : Anti-ME3 antibody (ab222857) at 1/2000 dilution

    Lane 1 : Mouse kidney lysate
    Lane 2 : Mouse brain lysate

    Predicted band size: 67 kDa
    Observed band size: 68 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human thyroid tissue stained for ME3 using ab222857 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid tissue stained for ME3 using ab222857 at 1/100 dilution in immunohistochemical analysis.

References

ab222857 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up