Overview

  • Product name

    Anti-MEAF6 antibody
  • Description

    Rabbit polyclonal to MEAF6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Zebrafish
  • Immunogen

    Synthetic peptide within Human MEAF6 aa 3-52 (N terminal). The exact sequence is proprietary. Numbering is based off mature sequence
    Sequence:

    HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM


    Database link: Q9HAF1

  • Positive control

    • Jurkat cell lysate; human kidney tissue.
  • General notes

    Previously labelled as C1orf149.

Properties

Applications

Our Abpromise guarantee covers the use of ab42472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

WB Use a concentration of 0.5 µg/ml. Detects a band of approximately 24 kDa (predicted molecular weight: 22 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use a concentration of 4 - 8 µg/ml.

Target

  • Function

    Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
  • Involvement in disease

    A chromosomal aberration involving MEAF6 may be a cause of endometrial stromal tumors. Translocation t(1;6)(p34;p21) with PHF1.
  • Sequence similarities

    Belongs to the EAF6 family.
  • Cellular localization

    Nucleus, nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • C1orf149 antibody
    • CDABP0189 antibody
    • Chromatin modification-related protein MEAF6 antibody
    • Chromosome 1 open reading frame 149 antibody
    • Eaf6 antibody
    • EAF6_HUMAN antibody
    • Esa1-associated factor 6 homolog antibody
    • FLJ11730 antibody
    • hEAF6 antibody
    • Hypothetical protein LOC64769 antibody
    • MEAF6 antibody
    • MYST/Esa1-associated factor 6 antibody
    • NY SAR 91 antibody
    • Protein EAF6 homolog antibody
    • RP3 423B22.2 antibody
    • Sarcoma antigen NY SAR 91 antibody
    • Sarcoma antigen NY-SAR-91 antibody
    see all

Images

  • Anti-MEAF6 antibody (ab42472) at 0.5 µg/ml + Jurkat cell lyste at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 22 kDa
    Observed band size: 24 kDa
    why is the actual band size different from the predicted?



    Diluted in 5% skim milk / PBS buffer, gel concentration 12%
  • ab42472 at 8µg/ml staining human kidney for MEAF6. Arrows indicate staining of epithelial cells of collecting tubules.

References

ab42472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab42472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up