Anti-Measles Large Fusion Protein antibody - C-terminal (ab203023)

Overview

  • Product name
    Anti-Measles Large Fusion Protein antibody - C-terminal
  • Description
    Rabbit polyclonal to Measles Large Fusion Protein - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Other species
  • Immunogen

    Synthetic peptide within Measles Large Fusion Protein aa 510-550 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    IPALICCCRGRCNKKGEQVGMSRPGLKPDLTGTSKSYVRSL


    Database link: P69353

  • Positive control
    • Mouse brain lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 0.01% BSA, 50% Glycerol

    Aqueous buffered solution.
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Detects a band of approximately 55 kDa (predicted molecular weight: 55 kDa).
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

  • Relevance
    Measles virus belongs to the Paramyxoviridae family within the Mononegavirales order. The Fusion protein, as its name suggests, is responsible for membrane fusion, essential for penetration into the host cell and subsequent initiation of the virus replicative cycle. Biological activity of the fusion protein is generated by endoproteolytic cleavage of a precursor protein (F0) into a large F1 subunit and a smaller F2 subunit held together by disulfide bonds.
  • Cellular localization
    Virion membrane; Single-pass type I membrane protein (By similarity). Cell membrane.
  • Database links
    • Alternative names
      • F antibody
      • Fusion glycoprotein F0 antibody
      • Fusion protein antibody

    References

    ab203023 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (CD46+ mouse brain lysate)
    Gel Running Conditions
    Reduced Denaturing (10% Bis-Tris gel)
    Loading amount
    20 µg
    Specification
    CD46+ mouse brain lysate
    Blocking step
    Odyssey Blocking Buffer as blocking agent for 30 minute(s) · Concentration: 50% · Temperature: 24°C
    Username

    Lauren Valued Customer

    Verified customer

    Submitted Mar 21 2018

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up