Anti-MED3 antibody (ab172363)
Key features and details
- Mouse polyclonal to MED3
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-MED3 antibody
See all MED3 primary antibodies -
Description
Mouse polyclonal to MED3 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow, Pig, Xenopus laevis, Zebrafish, Orangutan, Xenopus tropicalis -
Immunogen
Full length protein corresponding to Human MED3 aa 1-311. (NP_004260.2)
Sequence:MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREK AFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDK TPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKA QPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKV IVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTAL LHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFR TLEAFHDTCRQ
Database link: Q6P2C8 -
Positive control
- MED3 transfected 293T cell lysate
-
General notes
This product was previously labelled as CRSP8
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab172363 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa. |
Target
-
Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. -
Sequence similarities
Belongs to the Mediator complex subunit 27 family. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 525389 Cow
- Entrez Gene: 9442 Human
- Entrez Gene: 68975 Mouse
- Entrez Gene: 100174637 Orangutan
- Entrez Gene: 414430 Pig
- Entrez Gene: 496548 Xenopus tropicalis
- Entrez Gene: 393633 Zebrafish
- Omim: 605044 Human
see all -
Alternative names
- Cofactor required for Sp1 transcriptional activation subunit 8 (34kD) antibody
- Cofactor required for Sp1 transcriptional activation subunit 8 34kDa antibody
- Cofactor required for Sp1 transcriptional activation subunit 8 antibody
see all
Images
Datasheets and documents
References (0)
ab172363 has not yet been referenced specifically in any publications.