For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    med3-antibody-ab172363.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Transcription Mediator Complex
Share by email

Anti-MED3 antibody (ab172363)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-MED3 antibody (ab172363)

    Key features and details

    • Mouse polyclonal to MED3
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant Human MED3 protein (ab160491)
    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-MED3 antibody
      See all MED3 primary antibodies
    • Description

      Mouse polyclonal to MED3
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Cow, Pig, Xenopus laevis, Zebrafish, Orangutan, Xenopus tropicalis
    • Immunogen

      Full length protein corresponding to Human MED3 aa 1-311. (NP_004260.2)
      Sequence:

      MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREK AFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDK TPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKA QPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKV IVVMRSLFIDRTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTAL LHYQLPQMPDVVVRSFMTWLRSYIKLFQAPCQRCGKFLQDGLPPTWRDFR TLEAFHDTCRQ


      Database link: Q6P2C8
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • MED3 transfected 293T cell lysate
    • General notes

       This product was previously labelled as CRSP8

       

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.4
      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Epigenetics and Nuclear Signaling
      • Transcription
      • Mediator Complex

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG - Isotype Control (ab37355)
    • Recombinant Protein

      • Recombinant Human MED3 protein (ab160491)

    Applications

    Our Abpromise guarantee covers the use of ab172363 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

    Target

    • Function

      Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
    • Sequence similarities

      Belongs to the Mediator complex subunit 27 family.
    • Cellular localization

      Nucleus.
    • Target information above from: UniProt accession Q6P2C8 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 525389 Cow
      • Entrez Gene: 9442 Human
      • Entrez Gene: 68975 Mouse
      • Entrez Gene: 100174637 Orangutan
      • Entrez Gene: 414430 Pig
      • Entrez Gene: 496548 Xenopus tropicalis
      • Entrez Gene: 393633 Zebrafish
      • Omim: 605044 Human
      • SwissProt: Q2TBN7 Cow
      • SwissProt: Q6P2C8 Human
      • SwissProt: Q9DB40 Mouse
      • SwissProt: Q5R6U8 Orangutan
      • SwissProt: Q6Q7J5 Pig
      • SwissProt: Q3B8G8 Xenopus laevis
      • SwissProt: Q642Q3 Xenopus laevis
      • SwissProt: Q5XHA1 Xenopus tropicalis
      • SwissProt: Q6PFL0 Zebrafish
      • Unigene: 374262 Human
      • Unigene: 330109 Mouse
      • Unigene: 46895 Xenopus laevis
      • Unigene: 79827 Zebrafish
      see all
    • Alternative names

      • Cofactor required for Sp1 transcriptional activation subunit 8 (34kD) antibody
      • Cofactor required for Sp1 transcriptional activation subunit 8 34kDa antibody
      • Cofactor required for Sp1 transcriptional activation subunit 8 antibody
      • CRAP 34 antibody
      • CRAP34 antibody
      • CRSP 34 antibody
      • CRSP 8 antibody
      • CRSP complex subunit 8 antibody
      • CRSP34 antibody
      • CRSP8 antibody
      • MED 27 antibody
      • Med27 antibody
      • MED27_HUMAN antibody
      • Mediator complex subunit 27 antibody
      • Mediator of RNA polymerase II transcription subunit 27 antibody
      • MGC11274 antibody
      • P37 TRAP/SMCC/PC2 subunit antibody
      • Transcriptional coactivator CRSP34 antibody
      • TRAP 37 antibody
      • TRAP37 antibody
      see all

    Images

    • Western blot - Anti-MED3 antibody (ab172363)
      Western blot - Anti-MED3 antibody (ab172363)
      All lanes : Anti-MED3 antibody (ab172363) at 1/500 dilution

      Lane 1 : MED3 transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Predicted band size: 35 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab172363? Please let us know so that we can cite the reference in this datasheet.

    ab172363 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab172363.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.