
  • Product name

  • Description

    Rabbit polyclonal to MED31
  • Host species

  • Tested applications

    Suitable for: WB, ChIPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 1-50 (MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFV N) of Human MED31 (NP_057144).

  • Positive control

    • Human fetal liver lysate.



Our Abpromise guarantee covers the use of ab98142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 16 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ChIP Use at an assay dependent concentration.


  • Relevance

    MED31 is a member of the mediator complex that can act as both a positive and negative regulator of transcription. The mediator complex interacts with RNA pol II and its associated proteins, the general transcription factors. Mediator proteins serve as a bridge connecting the activator and basal transcription machinery.
  • Cellular localization

  • Database links

  • Alternative names

    • SOH1 antibody
    • CGI-125 antibody
    • hSOH1 antibody
    • Mediator complex subunit 31 antibody
    • Mediator complex subunit SOH1 antibody
    • Mediator of RNA polymerase II transcription subunit 31 antibody
    • Mediator of RNA polymerase II transcription subunit 31 homolog antibody
    see all


  • Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30 minutes) or (0, 30, 60 minutes) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

  • Anti-MED31 antibody (ab98142) at 1 µg/ml (5% skim milk / PBS buffer) + Human fetal liver lysate at 10 µg

    HRP conjugated anti-Rabbit IgG diluted 1/50,000

    Predicted band size: 16 kDa

    Gel concentration: 10-20%


ab98142 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98142.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up