Overview

  • Product name

    Anti-MED9 antibody [OTI7F11]
    See all MED9 primary antibodies
  • Description

    Mouse monoclonal [OTI7F11] to MED9
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human MED9 aa 1-146. Produced in E.coli (NP_060489).
    Sequence:

    MASAGVAAGRQAEDVLPPTSDQPLPDTKPLPPPQPPPVPAPQPQQSPAPR PQSPARAREEENYSFLPLVHNIIKCMDKDSPEVHQDLNALKSKFQEMRKL ISTMPGIHLSPEQQQQQLQSLREQVRTKNELLQKYKSLCMFEIPKE


    Database link: Q9NWA0

  • Positive control

    • WB: pCMV6-ENTRY MED9 cDNA transfected HEK-293T cell lysate. IHC-P: Human breast and prostate carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab236399 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000.

Heat-induced epitope retrieval by 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

WB 1/2000. Predicted molecular weight: 16 kDa.

Target

  • Relevance

    MED9 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • FLJ10193 antibody
    • MED25 antibody
    • MED9 antibody
    • Mediator complex subunit 9 antibody
    • mediator of RNA polymerase II transcription subunit 9 antibody
    • mediator of RNA polymerase II transcription, subunit 9 homolog antibody
    • Mediator subunit 25 antibody
    • MGC138234 antibody
    see all

Images

  • All lanes : Anti-MED9 antibody [OTI7F11] (ab236399) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY MED9 cDNA transfected HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 16 kDa

  • Paraffin-embedded human prostate carcinoma tissue stained for MED9 using ab236399 at 1/1000 dilution in immunohistochemical analysis.

    Heat-induced epitope retrieval was performed using 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

  • Paraffin-embedded human breast tissue stained for MED9 using ab236399 at 1/1000 dilution in immunohistochemical analysis.

    Heat-induced epitope retrieval was performed using 1 mM EDTA in 10 mM Tris buffer (pH 8.5) at 120°C for 3 minutes.

References

ab236399 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236399.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up