Overview

  • Product name

  • Description

    Rabbit polyclonal to MEF2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human MEF2B aa 65-205.
    Sequence:

    VLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFR RLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQ SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTE


    Database link: Q02080

  • Positive control

    • IHC-P: Human lymph node tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.
  • Tissue specificity

    Expressed in skeletal and cardiac muscle and brain.
  • Sequence similarities

    Belongs to the MEF2 family.
    Contains 1 MADS-box domain.
    Contains 1 Mef2-type DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MADS box transcription enhancer factor 2 antibody
    • MDS1 EVI1 antibody
    • Mef2b antibody
    • MEF2B_HUMAN antibody
    • Myocyte enhancer factor 2B antibody
    • Myocyte specific enhancer factor 2B antibody
    • Myocyte-specific enhancer factor 2B antibody
    • PRDM3 antibody
    • RSRFR2 antibody
    • Serum response factor like protein 2 antibody
    • Serum response factor-like protein 2 antibody
    • XMEF2 antibody
    see all

Images

  • Paraffin-embedded human lymph node tissue stained for MEFB2 with ab224233  (1/200) in immunohistochemical analysis.

References

ab224233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up