Overview

  • Product name
  • Description
    Rabbit polyclonal to MEF2B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, EMSA, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment, corresponding to amino acids 234-365 of Human MEF2B

Properties

Applications

Our Abpromise guarantee covers the use of ab33540 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 39 kDa.
EMSA Use at an assay dependent dilution. Use 0.1µl per sample.
IP Use at an assay dependent dilution. Use 4µl for 1ml cell lysate.

Target

  • Function
    Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.
  • Tissue specificity
    Expressed in skeletal and cardiac muscle and brain.
  • Sequence similarities
    Belongs to the MEF2 family.
    Contains 1 MADS-box domain.
    Contains 1 Mef2-type DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • MADS box transcription enhancer factor 2 antibody
    • MDS1 EVI1 antibody
    • Mef2b antibody
    • MEF2B_HUMAN antibody
    • Myocyte enhancer factor 2B antibody
    • Myocyte specific enhancer factor 2B antibody
    • Myocyte-specific enhancer factor 2B antibody
    • PRDM3 antibody
    • RSRFR2 antibody
    • Serum response factor like protein 2 antibody
    • Serum response factor-like protein 2 antibody
    • XMEF2 antibody
    see all

References

This product has been referenced in:
  • Pon JR  et al. MEF2B mutations in non-Hodgkin lymphoma dysregulate cell migration by decreasing MEF2B target gene activation. Nat Commun 6:7953 (2015). IP ; Human . Read more (PubMed: 26245647) »
  • Ryan RJ  et al. Detection of Enhancer-Associated Rearrangements Reveals Mechanisms of Oncogene Dysregulation in B-cell Lymphoma. Cancer Discov 5:1058-71 (2015). Read more (PubMed: 26229090) »
See all 7 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

The immunogen of ab33540 derives from the protein MEF2B isoform b, http://www.ncbi.nlm.nih.gov/protein/5174543. It is originally from the gene RSRFR2 described in Pollack and Treisman, Genes and Development 1991.

The immunogen sequence is aa 234-365 of Human MEF2B:
NPCSTATPGPPLGSFPFLPGGPPVGAEAWARRVPQPAAPPRRPPQSASSLSASLRPP
GAPATFLRPSPIPCSSPGPWQSLCGLGPPCAGCPWPTAGPGRRSPGGTSPERSPGT
ARARGDPTSLQASSEKTQQ

Please note that the first 23 amino acids (NPCSTATPGPPLGSFPFLPGGPP) are conserved in isoform 2 of MEF2B, therefore this polyclonal antibody ab33540 may detect both isoforms.

Read More

Answer

Muchas gracias por tomarte la molestia de mandarnos el cuestionario y las imágenes.

He estudiado el protocolo enviado, y hay una serie de sugerencias que me gustaría haceros para intentar mejorar los resultados del anticuerpo.

De cualquier manera, al estar el anticuerpo bajo garantía, en caso de que las sugerencias no consiguieran optimizar el protocolo, estaré encantada de ofreceros un reemplazo del mismo, o un vale sin caducidad o reembolso si preferís.

- Este anticuerpo reconoce la proteína en condiciones desnaturalizantes y reductoras. Para optimizar estas condiciones, y siendo que trabajáis con una proteína nuclear, sugeriría usar RIPA como buffer de lisis. La receta la podéis encontrar en el siguiente protocolo: https://www.abcam.com/index.html?pageconfig=resource&rid=11379#A1.

Para asegurar condiciones reductoras, utilizar un agente reductor como DTT o BME, además de hervir las muestras durante 5-10 minutos.

- La membrana se ha cargado en exceso. Solemos recomendar una carga por calle de 10-20 ug. Mas cantidad de proteína puede provocar la aparición de bandas inespecíficas.

- Por último, en lugar de incubar los anticuerpos en leche, para evitar bloqueo en exceso de posiciones específicas, os sugiero hacerlo en TBST.

- Para comprobar que las bandas inespecíficas no proceden del secundario, está bien hacer un control no primario, incubando solo el secundario y verificar así si las bandas siguen estando presentes.

Espero que estos consejos os permitan obtener mejores resultados del anticuerpo. En caso de que no sea así, por favor, no dudéis en contactarnos de nuevo para que podamos ayudaros a resolver el problema lo más rápido y eficazmente posible.

Que paséis un buen día.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up